Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC7 Peptide - N-terminal region

CCDC7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BIOT2, BioT2-A, BioT2-B, BioT2-C, C10orf68

UniProt

Q9H943

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC7 Rabbit Polyclonal Antibody (orb325893) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078964

Preservative

Lyophilized powder

AA Sequence

EQTYQAAEKSQAHNEVPNERLVVEHQESLSKTKLQIKKQETSTEQPLTTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STOmL2 (NM_013442) Human Recombinant Protein
TP760086 50 µg

STOmL2 (NM_013442) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Glycoprotein / GP (Virion spike glycoprotein) Protein (His Tag)
PKSV030150 100 µg

Recombinant EBOV (subtype Zaire, strain H.sapiens-wt/GIN/2014/Kissidougou-C15) Glycoprotein / GP (Virion spike glycoprotein) Protein (His Tag)

Sign In for Pricing
View Details
Multi-parameter Analyzer BMET-1107
BMET-1107 1 Unit

Multi-parameter Analyzer BMET-1107

Sign In for Pricing
View Details
Lobetyolin
TRC-L469355-5MG 5 mg

Lobetyolin

Sign In for Pricing
View Details
Human C16orf91 activation kit by CRISPRa
GA117073 1 Kit

Human C16orf91 activation kit by CRISPRa

Sign In for Pricing
View Details
hnRNP F (HNRNPF) (NM_001098208) Human Over-expression Lysate
LY426004 100 µg

hnRNP F (HNRNPF) (NM_001098208) Human Over-expression Lysate

Sign In for Pricing
View Details