Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bloc1s2 Peptide - N-terminal region

Bloc1s2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2410089B13Rik, BLOS2

UniProt

Q9CWG9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bloc1s2 Rabbit Polyclonal Antibody (orb582848) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082883

Preservative

Lyophilized powder

AA Sequence

KEPAEADINELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tbc1d4 Mouse Gene Knockout Kit (CRISPR)
KN517256 1 Kit

Tbc1d4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mitofusin 1 (MFN1) (Center) Rabbit Polyclonal Antibody
AP52679PU-N 400 µL

Mitofusin 1 (MFN1) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bromocresol purple *CAS 115-40-2* *Ultrapure grade*
92-AAT 25 g

Bromocresol purple *CAS 115-40-2* *Ultrapure grade*

Sign In for Pricing
View Details
ARMCX1 Polyclonal Antibody
E-AB-10839-01 20 µL

ARMCX1 Polyclonal Antibody

Sign In for Pricing
View Details
ARMCX1 Polyclonal Antibody
E-AB-10839-02 60 µL

ARMCX1 Polyclonal Antibody

Sign In for Pricing
View Details
ARMCX1 Polyclonal Antibody
E-AB-10839-03 120 µL

ARMCX1 Polyclonal Antibody

Sign In for Pricing
View Details