Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bloc1s2 Peptide - N-terminal region

Bloc1s2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2410089B13Rik, BLOS2

UniProt

Q9CWG9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bloc1s2 Rabbit Polyclonal Antibody (orb582848) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_082883

Preservative

Lyophilized powder

AA Sequence

KEPAEADINELCRDMFSKMATYLTGELTATSEDYKLLENMNKLTSLKYLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin-cAMP, 50 ug
#00020-1 20x 50 µg

Biotin-cAMP, 50 ug

Sign In for Pricing
View Details
Human RHBG activation kit by CRISPRa
GA111392 1 Kit

Human RHBG activation kit by CRISPRa

Sign In for Pricing
View Details
PCB (PC) (NM_000920) Human Over-expression Lysate
LY400340 100 µg

PCB (PC) (NM_000920) Human Over-expression Lysate

Sign In for Pricing
View Details
SuperLight™ Luciferase Reporter Gene Assay Kit
SLLU-200 200 Tests

SuperLight™ Luciferase Reporter Gene Assay Kit

Sign In for Pricing
View Details
10X Buffer V5, 5 x 1ml
RB0212 5x 1 mL

10X Buffer V5, 5 x 1ml

Sign In for Pricing
View Details
CD33 (C33/69), CF740 conjugate, 0.1mg/mL
BNC740069-100 1x 100 µL

CD33 (C33/69), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details