Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gtf2h5 Peptide - N-terminal region

Gtf2h5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2700017P07Rik, 2810432H05Rik, D17Wsu155e

UniProt

Q8K2X8

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gtf2h5 Rabbit Polyclonal Antibody (orb582965) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_852057

Preservative

Lyophilized powder

AA Sequence

QFLLYLDEANALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Cytosine deaminase antibody
SL2950R-01 50 µL

Rabbit Anti-Cytosine deaminase antibody

Sign In for Pricing
View Details
Rabbit Anti-Cytosine deaminase antibody
SL2950R-02 100 µL

Rabbit Anti-Cytosine deaminase antibody

Sign In for Pricing
View Details
SQLE Antibody - C-terminal region : HRP (ARP42101_P050-HRP)
ARP42101_P050-HRP 100 µL

SQLE Antibody - C-terminal region : HRP (ARP42101_P050-HRP)

Sign In for Pricing
View Details
TPM2 Antibody
orb2676115-01 50 µL

TPM2 Antibody

Sign In for Pricing
View Details
TPM2 Antibody
orb2676115-02 100 µL

TPM2 Antibody

Sign In for Pricing
View Details
TPM2 Antibody
orb2676115-03 200 µL

TPM2 Antibody

Sign In for Pricing
View Details