Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gtf2h5 Peptide - N-terminal region

Gtf2h5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

2700017P07Rik, 2810432H05Rik, D17Wsu155e

UniProt

Q8K2X8

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gtf2h5 Rabbit Polyclonal Antibody (orb582965) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_852057

Preservative

Lyophilized powder

AA Sequence

QFLLYLDEANALGKKFIIQDIDDTHVFVIAELVNVLQERVGELMDQNAFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zinc bis (trifluoromethylsulfonyl) imide
KI-0062-HP-0500 500 g

Zinc bis (trifluoromethylsulfonyl) imide

Sign In for Pricing
View Details
NMT1 (E-9)
sc-393702 200 µg/mL

NMT1 (E-9)

Sign In for Pricing
View Details
GNPATP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0879107 1.0 µg DNA

GNPATP sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rabbit anti-TTF2 Antibody, Affinity Purified
A303-108A-T 10 µg

Rabbit anti-TTF2 Antibody, Affinity Purified

Sign In for Pricing
View Details
P47-phox discontinued
540537-01 30ul

P47-phox discontinued

Sign In for Pricing
View Details
P47-phox discontinued
540537-02 100 µL

P47-phox discontinued

Sign In for Pricing
View Details