Rab27a Peptide - middle region
Rab27a Peptide - middle region
Product Specifications
Product Name Alternative
2210402C08Rik, 2410003M20Rik, 4933437C11Rik, ash
UniProt
Q9ERI2
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Rab27a Rabbit Polyclonal Antibody (orb583218) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_076124
Preservative
Lyophilized powder
AA Sequence
DAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
37954066 1.0 µg DNA
PSMB10 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
PC1005467-01 100 mg
2- ((4-Ethyl-5-phenyl-4H-1,2,4-triazol-3-yl) thio) -1- (4-fluorophenyl) ethan-1-one
Sign In for Pricing
View Details PC1005467-02 250 mg
2- ((4-Ethyl-5-phenyl-4H-1,2,4-triazol-3-yl) thio) -1- (4-fluorophenyl) ethan-1-one
Sign In for Pricing
View Details PC1005467-03 1 g
2- ((4-Ethyl-5-phenyl-4H-1,2,4-triazol-3-yl) thio) -1- (4-fluorophenyl) ethan-1-one
Sign In for Pricing
View Details