Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lrrc40 Peptide - C-terminal region

Lrrc40 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2610040E16Rik, AI837674

UniProt

Q9CRC8

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lrrc40 Rabbit Polyclonal Antibody (orb583418) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_077156

Preservative

Lyophilized powder

AA Sequence

VLYRISTLEAVLISNNQVGSVDPQKMKLMENLNTLDLQNNDLLQIPPELG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPV16 E2 (Human Papilloma Virus 16) (TVG 261), CF740 conjugate, 0.1mg/mL
BNC743073-100 1x 100 µL

HPV16 E2 (Human Papilloma Virus 16) (TVG 261), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C19orf75 (SIGLECL1) Human qPCR Primer Pair (NM_173635)
HP218429 200 Reactions

C19orf75 (SIGLECL1) Human qPCR Primer Pair (NM_173635)

Sign In for Pricing
View Details
5-[(7-Chloro-4-quinolinyl)amino]-2-hydroxybenzaldehyde
TRC-C381350-2.5MG 2.5 mg

5-[(7-Chloro-4-quinolinyl)amino]-2-hydroxybenzaldehyde

Sign In for Pricing
View Details
Dihydroxy Chrysanthemic Acid
TRC-D552910-50MG 50 mg

Dihydroxy Chrysanthemic Acid

Sign In for Pricing
View Details
SH2D5 (NM_001103161) Human Over-expression Lysate
LY420198 100 µg

SH2D5 (NM_001103161) Human Over-expression Lysate

Sign In for Pricing
View Details
(5E)-5-(3-Bromopropylidene)-10,11-dihydro-5H-dibenzo[a,d]cyclohepten-10-ol
TRC-B471365-5MG 5 mg

(5E)-5-(3-Bromopropylidene)-10,11-dihydro-5H-dibenzo[a,d]cyclohepten-10-ol

Sign In for Pricing
View Details