HMCES Peptide - N-terminal region
HMCES Peptide - N-terminal region
Product Specifications
Product Name Alternative
Srap1, C85376, 8430410A17Rik
UniProt
Q8R1M0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HMCES Rabbit Polyclonal Antibody (orb326195) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_776098
Preservative
Lyophilized powder
AA Sequence
SYNKSPQSSSPVLLSRLHFEKDADSSDRIIIPMRWGLVPSWFKESDPSKL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
HA751608 100 µL
ATPase Inhibitory Factor 1 / IF1 Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
#31066 1 Kit
AccuGreenTM High Sensitivity dsDNA Quantitation Kit (500 assays)
Sign In for Pricing
View Details 
BNUB1777-100 1x 100 µL
Prostate Specific Antigen (PSA) (3E6), 0.2mg/mL
Sign In for Pricing
View Details 