Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMCES Peptide - N-terminal region

HMCES Peptide - N-terminal region

Product Specifications

Product Name Alternative

Srap1, C85376, 8430410A17Rik

UniProt

Q8R1M0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HMCES Rabbit Polyclonal Antibody (orb326195) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_776098

Preservative

Lyophilized powder

AA Sequence

SYNKSPQSSSPVLLSRLHFEKDADSSDRIIIPMRWGLVPSWFKESDPSKL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEACAM6 Mouse monoclonal Antibody [A1E2]
EM1901-68-50UL 50 µL

CEACAM6 Mouse monoclonal Antibody [A1E2]

Sign In for Pricing
View Details
Recombinant Human AMIGO2 Protein (Fc Tag)
PKSH033770-01 10 µg

Recombinant Human AMIGO2 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human AMIGO2 Protein (Fc Tag)
PKSH033770-02 50 µg

Recombinant Human AMIGO2 Protein (Fc Tag)

Sign In for Pricing
View Details
(1S)-(-)-Alpha-Pinene
TRC-P466610-250ML 250 mL

(1S)-(-)-Alpha-Pinene

Sign In for Pricing
View Details
KDM2B (NM_001005366) Human Over-expression Lysate
LY423701 100 µg

KDM2B (NM_001005366) Human Over-expression Lysate

Sign In for Pricing
View Details
Natural Convection Incubator BINC-7803
BINC-7803 1 Unit

Natural Convection Incubator BINC-7803

Sign In for Pricing
View Details