Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Acbd3 Peptide - middle region

Acbd3 Peptide - middle region

Product Specifications

UniProt

Q7TNY6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Acbd3 Rabbit Polyclonal Antibody (orb326225) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_878263

Preservative

Lyophilized powder

AA Sequence

RIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Polyclonal Antibody to Vitronectin (VTN)
MBS2050868-01 0.1 mL

PE-Linked Polyclonal Antibody to Vitronectin (VTN)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Vitronectin (VTN)
MBS2050868-02 0.2 mL

PE-Linked Polyclonal Antibody to Vitronectin (VTN)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Vitronectin (VTN)
MBS2050868-03 0.5 mL

PE-Linked Polyclonal Antibody to Vitronectin (VTN)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Vitronectin (VTN)
MBS2050868-04 1 mL

PE-Linked Polyclonal Antibody to Vitronectin (VTN)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Vitronectin (VTN)
MBS2050868-05 5 mL

PE-Linked Polyclonal Antibody to Vitronectin (VTN)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Vitronectin (VTN)
MBS2050868-06 5x 5 mL

PE-Linked Polyclonal Antibody to Vitronectin (VTN)

Sign In for Pricing
View Details