Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Acbd3 Peptide - middle region

Acbd3 Peptide - middle region

Product Specifications

UniProt

Q7TNY6

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Acbd3 Rabbit Polyclonal Antibody (orb326225) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_878263

Preservative

Lyophilized powder

AA Sequence

RIEEERLRLEQQKQQIMAALNSQTAVQFQQYAAQQYPGNYEQQQILIRQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPRE Protein Lysate (Mouse) with C-HA Tag
38173034 100 µg

PTPRE Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Mouse Monoclonal Glucagon R/GCGR Antibody (591929) [mFluor Violet 610 SE]
FAB10296MFV610 0.1 mL

Mouse Monoclonal Glucagon R/GCGR Antibody (591929) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
pCMV-GPX4-3-3×FLAG-SV40-Neo Plasmid
PVT44499 2 µg

pCMV-GPX4-3-3×FLAG-SV40-Neo Plasmid

Sign In for Pricing
View Details
α-actinin-2 CRISPR Activation Plasmid (h)
sc-401186-ACT 20 µg

α-actinin-2 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Cxx1c siRNA (m)
sc-142646 10 µM

Cxx1c siRNA (m)

Sign In for Pricing
View Details
CSF2RB Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV648577 1.0 µg DNA

CSF2RB Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details