Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp36l1 Peptide - C-terminal region

Zfp36l1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AW742437, AW743212, Berg36, Brf1, D530020L18Rik, ERF1, TIS11b, cMG1

UniProt

P23950

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp36l1 Rabbit Polyclonal Antibody (orb583766) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031590

Preservative

Lyophilized powder

AA Sequence

PMSESPHMFDSPPSPQDSLSDHEGYLSSSSSSHSGSDSPTLDNSRRLPIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGFR3 (NM_000142) Human Over-expression Lysate
LY424902 100 µg

FGFR3 (NM_000142) Human Over-expression Lysate

Sign In for Pricing
View Details
POP4 (NM_006627) Human Over-expression Lysate
LC401980 20 µg

POP4 (NM_006627) Human Over-expression Lysate

Sign In for Pricing
View Details
Human IFNL4 activation kit by CRISPRa
GA119461 1 Kit

Human IFNL4 activation kit by CRISPRa

Sign In for Pricing
View Details
IFNAR1 Recombinant Rabbit monoclonal Antibody [SR45-08]
ET1602-37-50UL 50 µL

IFNAR1 Recombinant Rabbit monoclonal Antibody [SR45-08]

Sign In for Pricing
View Details
Recombinant Mouse GAD65/GAD2/GAD-2 Protein (His & GST Tag)
PKSM040560 50 µg

Recombinant Mouse GAD65/GAD2/GAD-2 Protein (His & GST Tag)

Sign In for Pricing
View Details
Cpsf7 Mouse Gene Knockout Kit (CRISPR)
KN503782 1 Kit

Cpsf7 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details