Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp36l1 Peptide - C-terminal region

Zfp36l1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AW742437, AW743212, Berg36, Brf1, D530020L18Rik, ERF1, TIS11b, cMG1

UniProt

P23950

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zfp36l1 Rabbit Polyclonal Antibody (orb583766) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031590

Preservative

Lyophilized powder

AA Sequence

PMSESPHMFDSPPSPQDSLSDHEGYLSSSSSSHSGSDSPTLDNSRRLPIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FAM219B activation kit by CRISPRa
GA111433 1 Kit

Human FAM219B activation kit by CRISPRa

Sign In for Pricing
View Details
Digital Desktop ultrasonic cleaner BULC-101
BULC-101 1 Unit

Digital Desktop ultrasonic cleaner BULC-101

Sign In for Pricing
View Details
CD57 / B3GAT1 (HNK-1), 0.2mg/mL
BNUB0136-100 1x 100 µL

CD57 / B3GAT1 (HNK-1), 0.2mg/mL

Sign In for Pricing
View Details
gp340 (DMBT1) Human Gene Knockout Kit (CRISPR)
KN415454 1 Kit

gp340 (DMBT1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TGFalpha (TG86), CF740 conjugate, 0.1mg/mL
BNC740786-500 1x 500 µL

TGFalpha (TG86), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (SPN/1766R), CF488A conjugate, 0.1mg/mL
BNC881766-100 1x 100 µL

CD43 (T-Cell Marker) (SPN/1766R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details