Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E2f5 Peptide - C-terminal region

E2f5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AU024671, E2F-5

UniProt

Q61502

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with E2f5 Rabbit Polyclonal Antibody (orb583804) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031918

Preservative

Lyophilized powder

AA Sequence

QPSSQSSTSVTPQKSTMAAQNLPEQHVSERSQTFQQTPAAEVSSGSISGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sync (NM_023485) Mouse Tagged ORF Clone Lentiviral Particle
MR215638L3V 200 µL

Sync (NM_023485) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CDK2 Rabbit Polyclonal Antibody (APC)
orb998629 100 µL

CDK2 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
CID5721353 50mg
A16192-50 50 mg

CID5721353 50mg

Sign In for Pricing
View Details
BM-1074
sc-503857 5 mg

BM-1074

Sign In for Pricing
View Details
CRA-026440 hydrochloride
M32865-01 1 g

CRA-026440 hydrochloride

Sign In for Pricing
View Details
CRA-026440 hydrochloride
M32865-02 500 mg

CRA-026440 hydrochloride

Sign In for Pricing
View Details