Acin1 Peptide - N-terminal region
Acin1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
2610036I19Rik, 2610510L13Rik, Acinus, Acn, C79325, acinusL, acinusS, mKIAA0670
UniProt
Q9JIX8
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Acin1 Rabbit Polyclonal Antibody (orb583933) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001078942
Preservative
Lyophilized powder
AA Sequence
HSPRKSSSFSEEKGESDDEKPRKGERRSSRVRQAKSKLPEYSQTAEEEED
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040676-500 1x 500 µL
MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC700977-500 1x 500 µL
TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880177-500 1x 500 µL
CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details