Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPM2A Peptide - N-terminal region

EPM2A Peptide - N-terminal region

Product Specifications

Product Name Alternative

EPM2, MELF

UniProt

O95278

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPM2A Rabbit Polyclonal Antibody (orb331224) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001018051

Preservative

Lyophilized powder

AA Sequence

ALALQEPGLWLGEVELAAEEAAQDGAEPGRVDTFWYKFLKREPGGELSWE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human WFDC9 activation kit by CRISPRa
GA116911 1 Kit

Human WFDC9 activation kit by CRISPRa

Sign In for Pricing
View Details
ASS1 Human Gene Knockout Kit (CRISPR)
KN201130RB 1 Kit

ASS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BCL10 (MALT-Lymphoma Marker) (151), CF568 conjugate, 0.1mg/mL
BNC681852-100 1x 100 µL

BCL10 (MALT-Lymphoma Marker) (151), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Triphenyl Phosphorothioate
TRC-T809005-25MG 25 mg

Triphenyl Phosphorothioate

Sign In for Pricing
View Details
PICALM Signaling Antibody Sampler Kit
HAK21026 1 Kit

PICALM Signaling Antibody Sampler Kit

Sign In for Pricing
View Details
DYRK3 Human Gene Knockout Kit (CRISPR)
KN401997 1 Kit

DYRK3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details