Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPM2A Peptide - N-terminal region

EPM2A Peptide - N-terminal region

Product Specifications

Product Name Alternative

EPM2, MELF

UniProt

O95278

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPM2A Rabbit Polyclonal Antibody (orb331224) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001018051

Preservative

Lyophilized powder

AA Sequence

ALALQEPGLWLGEVELAAEEAAQDGAEPGRVDTFWYKFLKREPGGELSWE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAD3 (MXD3) Mouse Monoclonal Antibody [Clone ID: N129/15]
75-250 100 µL

MAD3 (MXD3) Mouse Monoclonal Antibody [Clone ID: N129/15]

Sign In for Pricing
View Details
MIR323b Human qPCR Primer Pair (MI0014206)
HP300818 200 Reactions

MIR323b Human qPCR Primer Pair (MI0014206)

Sign In for Pricing
View Details
CD80 (B7-1) (C80/2776), CF568 conjugate, 0.1mg/mL
BNC682776-100 1x 100 µL

CD80 (B7-1) (C80/2776), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
D-Luciferin, FREE ACID
#10100-1 1x 50 mg

D-Luciferin, FREE ACID

Sign In for Pricing
View Details
GlycoLinerTM 400/420 Cell Surface Glycoprotein Labeling Kit, 100 Labelings
#30144-T 1 Kit

GlycoLinerTM 400/420 Cell Surface Glycoprotein Labeling Kit, 100 Labelings

Sign In for Pricing
View Details
Texas Red Conjugated Rabbit Affinity Purified Antibody to Human IgG
TAF-331-1 1 mL

Texas Red Conjugated Rabbit Affinity Purified Antibody to Human IgG

Sign In for Pricing
View Details