HLA-DMB Peptide - N-terminal region
HLA-DMB Peptide - N-terminal region
Product Specifications
Product Name Alternative
D6S221E, RING7
UniProt
P28068
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HLA-DMB Rabbit Polyclonal Antibody (orb585622) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002109
Preservative
Lyophilized powder
AA Sequence
FTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K3071307 1.0 µg DNA
Vmn2r91 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details EKC41575 96 Tests
Human Fibroblast Growth Factor 5 (Fgf5) Elisa Kit
Sign In for Pricing
View Details 
D8218 96 Tests
G Protein Coupled Receptor family C Group 5 member A (GPRC5A) Chicken ELISA Kit
Sign In for Pricing
View Details