Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-DMB Peptide - N-terminal region

HLA-DMB Peptide - N-terminal region

Product Specifications

Product Name Alternative

D6S221E, RING7

UniProt

P28068

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLA-DMB Rabbit Polyclonal Antibody (orb585622) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002109

Preservative

Lyophilized powder

AA Sequence

FTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-AKT1S1 (Thr246) Rabbit Polyclonal Antibody (Biotin)
orb501405 100 µL

Phospho-AKT1S1 (Thr246) Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Fas IgG1 Fc & Hinge Region, Fusion Protein (CD95, APO-1)
F0019-61M 25 µg

Fas IgG1 Fc & Hinge Region, Fusion Protein (CD95, APO-1)

Sign In for Pricing
View Details
Human RNA-binding Raly-like protein (RALYL) ELISA Kit
MBS287490-01 48 Tests

Human RNA-binding Raly-like protein (RALYL) ELISA Kit

Sign In for Pricing
View Details
Human RNA-binding Raly-like protein (RALYL) ELISA Kit
MBS287490-02 96 Tests

Human RNA-binding Raly-like protein (RALYL) ELISA Kit

Sign In for Pricing
View Details
Human RNA-binding Raly-like protein (RALYL) ELISA Kit
MBS287490-03 5x 96 Tests

Human RNA-binding Raly-like protein (RALYL) ELISA Kit

Sign In for Pricing
View Details
Human RNA-binding Raly-like protein (RALYL) ELISA Kit
MBS287490-04 10x 96 Tests

Human RNA-binding Raly-like protein (RALYL) ELISA Kit

Sign In for Pricing
View Details