Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMC1 Peptide - N-terminal region

DMC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DMC1H, HsLim15, LIM15, MGC150472, MGC150473, dJ199H16.1

UniProt

Q14565

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DMC1 Rabbit Polyclonal Antibody (orb585629) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_008999

Preservative

Lyophilized powder

AA Sequence

GIQMTTRRALCNVKGLSEAKVDKIKEAANKLIEPGFLTAFEYSEKRKMVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NANP Rabbit Polyclonal Antibody
TA366450 100 µL

NANP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ARF1 (Golgi Apparatus Marker) (ARF1/2117), 0.2mg/mL
BNUB2117-500 1x 500 µL

ARF1 (Golgi Apparatus Marker) (ARF1/2117), 0.2mg/mL

Sign In for Pricing
View Details
Omeprazole Sulfide Hydrochloride
TRC-O635060-25MG 25 mg

Omeprazole Sulfide Hydrochloride

Sign In for Pricing
View Details
Recombinant PNKP Monoclonal Antibody
AN302032L-01 50 µL

Recombinant PNKP Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant PNKP Monoclonal Antibody
AN302032L-02 100 µL

Recombinant PNKP Monoclonal Antibody

Sign In for Pricing
View Details
2-Bromo-5-nitrobenzaldehyde
TRC-B686160-25G 25 g

2-Bromo-5-nitrobenzaldehyde

Sign In for Pricing
View Details