Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXO1 Peptide - C-terminal region

EXO1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HEX1, hExoI

UniProt

E7EVV0

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXO1 Rabbit Polyclonal Antibody (orb331234) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003677

Preservative

Lyophilized powder

AA Sequence

TTKIKPLGPARASGLSKKPASIQKRKHHNAENKPGLQIKLNELWKNFGFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Doxifluridine
B2650-250 250 mg

Doxifluridine

Sign In for Pricing
View Details
MOF Monoclonal Antibody
E10-20140a 100 µg -100 µL

MOF Monoclonal Antibody

Sign In for Pricing
View Details
IGJ antibody
10R-6995 100 ul

IGJ antibody

Sign In for Pricing
View Details
CACD Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV720368 1.0 µg DNA

CACD Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
APC Anti-Human CD40 Antibody[G28.5]
E-AB-F1214E-01 20 Tests

APC Anti-Human CD40 Antibody[G28.5]

Sign In for Pricing
View Details
APC Anti-Human CD40 Antibody[G28.5]
E-AB-F1214E-02 100 Tests

APC Anti-Human CD40 Antibody[G28.5]

Sign In for Pricing
View Details