Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXO1 Peptide - C-terminal region

EXO1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HEX1, hExoI

UniProt

E7EVV0

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXO1 Rabbit Polyclonal Antibody (orb331234) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003677

Preservative

Lyophilized powder

AA Sequence

TTKIKPLGPARASGLSKKPASIQKRKHHNAENKPGLQIKLNELWKNFGFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Conjugated CBL (Phospho-Tyr774) Rabbit mAb
C14270 100 µL

Conjugated CBL (Phospho-Tyr774) Rabbit mAb

Sign In for Pricing
View Details
Human FOXR1 Recombinant Protein (N-His)
HD345012-01 50 µg

Human FOXR1 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human FOXR1 Recombinant Protein (N-His)
HD345012-02 100 µg

Human FOXR1 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human FOXR1 Recombinant Protein (N-His)
HD345012-03 1 mg

Human FOXR1 Recombinant Protein (N-His)

Sign In for Pricing
View Details
α-Methylcinnamylaldehyde
JH638203 1 Each

α-Methylcinnamylaldehyde

Sign In for Pricing
View Details
RANK (Osteoclast differentiation factor receptor) (FITC) discontinued
145118-FITC 100 µL

RANK (Osteoclast differentiation factor receptor) (FITC) discontinued

Sign In for Pricing
View Details