Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD207 Peptide - C-terminal region

CD207 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLEC4K

UniProt

Q9UJ71

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD207 Rabbit Polyclonal Antibody (orb585671) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056532

Preservative

Lyophilized powder

AA Sequence

GDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Krueppel-like factor 7, KLF7 ELISA Kit
MBS9327039-01 48 Well

Human Krueppel-like factor 7, KLF7 ELISA Kit

Sign In for Pricing
View Details
Human Krueppel-like factor 7, KLF7 ELISA Kit
MBS9327039-02 96 Well

Human Krueppel-like factor 7, KLF7 ELISA Kit

Sign In for Pricing
View Details
Human Krueppel-like factor 7, KLF7 ELISA Kit
MBS9327039-03 5x 96 Well

Human Krueppel-like factor 7, KLF7 ELISA Kit

Sign In for Pricing
View Details
Human Krueppel-like factor 7, KLF7 ELISA Kit
MBS9327039-04 10x 96 Well

Human Krueppel-like factor 7, KLF7 ELISA Kit

Sign In for Pricing
View Details
SOCS-3 Polyclonal Antibody
MBS8532516-01 0.1 mg

SOCS-3 Polyclonal Antibody

Sign In for Pricing
View Details
SOCS-3 Polyclonal Antibody
MBS8532516-02 0.1 mL (AF635)

SOCS-3 Polyclonal Antibody

Sign In for Pricing
View Details