Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD207 Peptide - C-terminal region

CD207 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLEC4K

UniProt

Q9UJ71

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD207 Rabbit Polyclonal Antibody (orb585671) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056532

Preservative

Lyophilized powder

AA Sequence

GDWSWVDDTPFNKVQSARFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL 3 Dog
OM296588-01 10 µg

IL 3 Dog

Sign In for Pricing
View Details
IL 3 Dog
OM296588-02 2 µg

IL 3 Dog

Sign In for Pricing
View Details
IL 3 Dog
OM296588-03 1 mg

IL 3 Dog

Sign In for Pricing
View Details
Recombinant Human FGF21 Protein (His Tag)
PKSH032440-01 20 µg

Recombinant Human FGF21 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human FGF21 Protein (His Tag)
PKSH032440-02 100 µg

Recombinant Human FGF21 Protein (His Tag)

Sign In for Pricing
View Details
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF488A conjugate, 0.1mg/mL
BNC881922-500 1x 500 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details