Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRR2A Peptide - N-terminal region

SPRR2A Peptide - N-terminal region

Product Specifications

UniProt

P35326

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPRR2A Rabbit Polyclonal Antibody (orb585681) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005979

Preservative

Lyophilized powder

AA Sequence

CPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPKSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-SPORT6-Chac1 Plasmid
PVT56161 2 µg

pCMV-SPORT6-Chac1 Plasmid

Sign In for Pricing
View Details
TEAD4-set siRNA/shRNA/RNAi Lentivector (Human)
46468091 4x 500 ng

TEAD4-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
SPICE1 Peptide - middle region
MBS3244969-01 0.1 mg

SPICE1 Peptide - middle region

Sign In for Pricing
View Details
SPICE1 Peptide - middle region
MBS3244969-02 5x 0.1 mg

SPICE1 Peptide - middle region

Sign In for Pricing
View Details
TOM1 Antibody
orb852142 2 mg

TOM1 Antibody

Sign In for Pricing
View Details
SHD Human Pre-designed siRNA Set A
HY-RS12861 1 Set

SHD Human Pre-designed siRNA Set A

Sign In for Pricing
View Details