Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRR2A Peptide - N-terminal region

SPRR2A Peptide - N-terminal region

Product Specifications

UniProt

P35326

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPRR2A Rabbit Polyclonal Antibody (orb585681) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005979

Preservative

Lyophilized powder

AA Sequence

CPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPKSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGHV1OR15-2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
24414111 3x 1.0 µg

IGHV1OR15-2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
[5-FAM]-TAT - (Fluorescent Peptides)
CRB1101019-01 0.1 mg

[5-FAM]-TAT - (Fluorescent Peptides)

Sign In for Pricing
View Details
[5-FAM]-TAT - (Fluorescent Peptides)
CRB1101019-02 0.5 mg

[5-FAM]-TAT - (Fluorescent Peptides)

Sign In for Pricing
View Details
[5-FAM]-TAT - (Fluorescent Peptides)
CRB1101019-03 1 mg

[5-FAM]-TAT - (Fluorescent Peptides)

Sign In for Pricing
View Details
Mouse Insulin Like Growth Factor Binding Protein 6 (IGFBP6) ELISA Kit
CK-bio-16408-01 48 Tests

Mouse Insulin Like Growth Factor Binding Protein 6 (IGFBP6) ELISA Kit

Sign In for Pricing
View Details
Mouse Insulin Like Growth Factor Binding Protein 6 (IGFBP6) ELISA Kit
CK-bio-16408-02 96 Tests

Mouse Insulin Like Growth Factor Binding Protein 6 (IGFBP6) ELISA Kit

Sign In for Pricing
View Details