Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPRR2A Peptide - N-terminal region

SPRR2A Peptide - N-terminal region

Product Specifications

UniProt

P35326

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPRR2A Rabbit Polyclonal Antibody (orb585681) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005979

Preservative

Lyophilized powder

AA Sequence

CPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPKSK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Transglutaminase 2 (TGM2) CLIA Kit
EKN51018 96 Tests

Human Transglutaminase 2 (TGM2) CLIA Kit

Sign In for Pricing
View Details
SP1 Rabbit Polyclonal Antibody (HRP)
orb479628 100 µL

SP1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Mouse Histidine Triad Nucleotide Binding Protein 2 (HINT2) ELISA Kit
EKN45919 96 Tests

Mouse Histidine Triad Nucleotide Binding Protein 2 (HINT2) ELISA Kit

Sign In for Pricing
View Details
RSPO1 Mouse Monoclonal Antibody [Clone 2F10]
E45M16519V-2 50 µL

RSPO1 Mouse Monoclonal Antibody [Clone 2F10]

Sign In for Pricing
View Details
IL1RN Recombinant Protein
OPCD04357-200UG 200 µg

IL1RN Recombinant Protein

Sign In for Pricing
View Details
Travoprost
S3738-5mg 5 mg

Travoprost

Sign In for Pricing
View Details