Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTBS Peptide - C-terminal region

CTBS Peptide - C-terminal region

Product Specifications

Product Name Alternative

CTB

UniProt

Q01459

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTBS Rabbit Polyclonal Antibody (orb585765) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004379

Preservative

Lyophilized powder

AA Sequence

WYGYDYTCLNLSEDHVCTIAKVPFRGAPCSDAAGRQVPYKTIMKQINSSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-MSK1 antibody
STJ94267 200 µl

Anti-MSK1 antibody

Sign In for Pricing
View Details
Monkey Complement Component 2 (C2) ELISA Kit
abx359214 96 Well

Monkey Complement Component 2 (C2) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal SLC39A7/ZIP7 Antibody [Allophycocyanin]
NBP2-97151APC 0.1 mL

Rabbit Polyclonal SLC39A7/ZIP7 Antibody [Allophycocyanin]

Sign In for Pricing
View Details
AFP Antibody
OM637004-01 100 µL

AFP Antibody

Sign In for Pricing
View Details
AFP Antibody
OM637004-02 20 µL

AFP Antibody

Sign In for Pricing
View Details
AFP Antibody
OM637004-03 50 µL

AFP Antibody

Sign In for Pricing
View Details