Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTBS Peptide - C-terminal region

CTBS Peptide - C-terminal region

Product Specifications

Product Name Alternative

CTB

UniProt

Q01459

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTBS Rabbit Polyclonal Antibody (orb585765) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004379

Preservative

Lyophilized powder

AA Sequence

WYGYDYTCLNLSEDHVCTIAKVPFRGAPCSDAAGRQVPYKTIMKQINSSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4930415F15Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3285507 1.0 µg DNA

4930415F15Rik sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
G-plus 17
OD305-1PK 1 unit

G-plus 17

Sign In for Pricing
View Details
Abt1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3984807 1.0 µg DNA

Abt1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
U1SNRNPBP (SNRNP35) CytoSection
TS403746P5 25 Slides

U1SNRNPBP (SNRNP35) CytoSection

Sign In for Pricing
View Details
Mouse Monoclonal Antibody to CCND1
sAP-1468 50 µg

Mouse Monoclonal Antibody to CCND1

Sign In for Pricing
View Details
RG3039
C06976-5mg 5 mg

RG3039

Sign In for Pricing
View Details