Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTBS Peptide - C-terminal region

CTBS Peptide - C-terminal region

Product Specifications

Product Name Alternative

CTB

UniProt

Q01459

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTBS Rabbit Polyclonal Antibody (orb585765) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004379

Preservative

Lyophilized powder

AA Sequence

WYGYDYTCLNLSEDHVCTIAKVPFRGAPCSDAAGRQVPYKTIMKQINSSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GFP hsa-miR-4772-3p AAV miRNA Vector
Amh1204700 500 ng

GFP hsa-miR-4772-3p AAV miRNA Vector

Sign In for Pricing
View Details
Vmn1r206 siRNA Oligos set (Mouse)
49612174 3x 5 nmol

Vmn1r206 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Lentiviral mouse Cplx3 shRNA (UAS) - Lentiviral mouse Cplx3 shRNA (UAS) plasmid
GTR15138307 1 Vial

Lentiviral mouse Cplx3 shRNA (UAS) - Lentiviral mouse Cplx3 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Adgrb3 Mouse shRNA Plasmid (Locus ID 210933)
TL511876 1 Kit

Adgrb3 Mouse shRNA Plasmid (Locus ID 210933)

Sign In for Pricing
View Details
NUGC-3
ARC0677 1 Million

NUGC-3

Sign In for Pricing
View Details
Anti-Integrin a2b3 (ITGA2 & ITGB3) Antibody (Tadocizumab)
F1578-1 1 mg

Anti-Integrin a2b3 (ITGA2 & ITGB3) Antibody (Tadocizumab)

Sign In for Pricing
View Details