Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTBS Peptide - C-terminal region

CTBS Peptide - C-terminal region

Product Specifications

Product Name Alternative

CTB

UniProt

Q01459

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTBS Rabbit Polyclonal Antibody (orb585765) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004379

Preservative

Lyophilized powder

AA Sequence

WYGYDYTCLNLSEDHVCTIAKVPFRGAPCSDAAGRQVPYKTIMKQINSSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal NPM1 Antibody (NPM1/3286) [Alexa Fluor 594]
NBP2-79875AF594 0.1 mL

Mouse Monoclonal NPM1 Antibody (NPM1/3286) [Alexa Fluor 594]

Sign In for Pricing
View Details
Recombinant Pseudomonas putida UPF0246 protein Pput_4436 (Pput_4436)
MBS1158844-01 0.02 mg (E-Coli)

Recombinant Pseudomonas putida UPF0246 protein Pput_4436 (Pput_4436)

Sign In for Pricing
View Details
Recombinant Pseudomonas putida UPF0246 protein Pput_4436 (Pput_4436)
MBS1158844-02 0.02 mg (Yeast)

Recombinant Pseudomonas putida UPF0246 protein Pput_4436 (Pput_4436)

Sign In for Pricing
View Details
Recombinant Pseudomonas putida UPF0246 protein Pput_4436 (Pput_4436)
MBS1158844-03 0.1 mg (E-Coli)

Recombinant Pseudomonas putida UPF0246 protein Pput_4436 (Pput_4436)

Sign In for Pricing
View Details
Recombinant Pseudomonas putida UPF0246 protein Pput_4436 (Pput_4436)
MBS1158844-04 0.1 mg (Yeast)

Recombinant Pseudomonas putida UPF0246 protein Pput_4436 (Pput_4436)

Sign In for Pricing
View Details
Recombinant Pseudomonas putida UPF0246 protein Pput_4436 (Pput_4436)
MBS1158844-05 0.02 mg (Baculovirus)

Recombinant Pseudomonas putida UPF0246 protein Pput_4436 (Pput_4436)

Sign In for Pricing
View Details