Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTBS Peptide - C-terminal region

CTBS Peptide - C-terminal region

Product Specifications

Product Name Alternative

CTB

UniProt

Q01459

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTBS Rabbit Polyclonal Antibody (orb585765) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004379

Preservative

Lyophilized powder

AA Sequence

WYGYDYTCLNLSEDHVCTIAKVPFRGAPCSDAAGRQVPYKTIMKQINSSI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal BCL11B Antibody [Janelia Fluor 549]
NB600-264JF549 0.1 mL

Rabbit Polyclonal BCL11B Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Mouse Monoclonal Ferritin Light Chain Antibody (FTL/1386) [Alexa Fluor 647]
NBP2-54574AF647 100 µL

Mouse Monoclonal Ferritin Light Chain Antibody (FTL/1386) [Alexa Fluor 647]

Sign In for Pricing
View Details
Human NTMT1 Protein, GST Tag
E40KMPH3135 20 µg

Human NTMT1 Protein, GST Tag

Sign In for Pricing
View Details
Cabiralizumab ELISA Kit
E100425 1 Each

Cabiralizumab ELISA Kit

Sign In for Pricing
View Details
TAPA1/CD81 Recombinant Rabbit mAb, IRDye800CW conjugated
orb2978840 100 µL

TAPA1/CD81 Recombinant Rabbit mAb, IRDye800CW conjugated

Sign In for Pricing
View Details
2,6-Dichlorophenylacetic acid methyl ester
FD21695-01 10 g

2,6-Dichlorophenylacetic acid methyl ester

Sign In for Pricing
View Details