Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zbtb37 Peptide - middle region

Zbtb37 Peptide - middle region

Product Specifications

Product Name Alternative

D430004I08Rik

UniProt

Q8C3U9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zbtb37 Rabbit Polyclonal Antibody (orb324358) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775600

Preservative

Lyophilized powder

AA Sequence

NLEEWLGPENQPSGEDGSSAEEVTAMVIDTTGHGSIGQESYTLGSSGAKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 18 (KRT18/834), CF405S conjugate, 0.1mg/mL
BNC040834-100 1x 100 µL

Cytokeratin 18 (KRT18/834), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APC Anti-Mouse CD27 Antibody[LG.3A10]
AN00322E-01 50 Tests

APC Anti-Mouse CD27 Antibody[LG.3A10]

Sign In for Pricing
View Details
APC Anti-Mouse CD27 Antibody[LG.3A10]
AN00322E-02 100 Tests

APC Anti-Mouse CD27 Antibody[LG.3A10]

Sign In for Pricing
View Details
APC Anti-Mouse CD27 Antibody[LG.3A10]
AN00322E-03 2x 100 Tests

APC Anti-Mouse CD27 Antibody[LG.3A10]

Sign In for Pricing
View Details
AGA (NM_000027) Human Over-expression Lysate
LY424971 100 µg

AGA (NM_000027) Human Over-expression Lysate

Sign In for Pricing
View Details
PBP (PEBP1) (NM_002567) Human Over-expression Lysate
LY400913 100 µg

PBP (PEBP1) (NM_002567) Human Over-expression Lysate

Sign In for Pricing
View Details