Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zbtb37 Peptide - middle region

Zbtb37 Peptide - middle region

Product Specifications

Product Name Alternative

D430004I08Rik

UniProt

Q8C3U9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Zbtb37 Rabbit Polyclonal Antibody (orb324358) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_775600

Preservative

Lyophilized powder

AA Sequence

NLEEWLGPENQPSGEDGSSAEEVTAMVIDTTGHGSIGQESYTLGSSGAKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc8a1 Mouse Gene Knockout Kit (CRISPR)
KN516202 1 Kit

Slc8a1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse LTF/LF Antibody Pair Set
E-KAB-0088 50 µL & 100 µg

Mouse LTF/LF Antibody Pair Set

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3283), CF640R conjugate, 0.1mg/mL
BNC403283-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/3283), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VEGF (Vascular Endothelial Growth Factor) (VG1), CF594 conjugate, 0.1mg/mL
BNC941686-100 1x 100 µL

VEGF (Vascular Endothelial Growth Factor) (VG1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR560141 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
Cytokeratin 19 (Pancreatic Stem Cell Marker) (rKRT19/800), CF640R conjugate, 0.1mg/mL
BNC401958-500 1x 500 µL

Cytokeratin 19 (Pancreatic Stem Cell Marker) (rKRT19/800), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details