Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bmi1 Peptide - middle region

Bmi1 Peptide - middle region

Product Specifications

Product Name Alternative

AW546694, Bmi-1, Pcgf4

UniProt

P25916

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bmi1 Rabbit Polyclonal Antibody (orb574774) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031578

Preservative

Lyophilized powder

AA Sequence

MDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trimethoprim lactate
orb1691000-01 200 mg

Trimethoprim lactate

Sign In for Pricing
View Details
Trimethoprim lactate
orb1691000-02 500 mg

Trimethoprim lactate

Sign In for Pricing
View Details
Trimethoprim lactate
orb1691000-03 1 ml x 10 mM (in DMSO)

Trimethoprim lactate

Sign In for Pricing
View Details
Neuropeptide Y Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-0071R-BF405 100 µL

Neuropeptide Y Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
ARTN hFc Chimera, Human
Z05042-500 500 µg

ARTN hFc Chimera, Human

Sign In for Pricing
View Details
CD66b (CEACAM8) Mouse Monoclonal Antibody [Clone ID: 80H3]
SM1154PT 20 µg

CD66b (CEACAM8) Mouse Monoclonal Antibody [Clone ID: 80H3]

Sign In for Pricing
View Details