Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bmi1 Peptide - middle region

Bmi1 Peptide - middle region

Product Specifications

Product Name Alternative

AW546694, Bmi-1, Pcgf4

UniProt

P25916

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Bmi1 Rabbit Polyclonal Antibody (orb574774) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031578

Preservative

Lyophilized powder

AA Sequence

MDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

M-CK Peptide
DF3072-BP 1 mg

M-CK Peptide

Sign In for Pricing
View Details
CAPN5 Rabbit Polyclonal Antibody
orb589068 100 µL

CAPN5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Centrin 1 (CETN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7G7]
TA804388BM 100 µL

Centrin 1 (CETN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7G7]

Sign In for Pricing
View Details
TMEM33 (NM_018126) Human Over-expression Lysate
LY402651 100 µg

TMEM33 (NM_018126) Human Over-expression Lysate

Sign In for Pricing
View Details
Protein Artemis (DCLRE1C) Antibody
abx232268 100 µg

Protein Artemis (DCLRE1C) Antibody

Sign In for Pricing
View Details
IPMK CRISPR/Cas9 KO Plasmid (h)
sc-404352 20 µg

IPMK CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details