Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Endou Peptide - middle region

Endou Peptide - middle region

Product Specifications

Product Name Alternative

Pp11r, Tcl-30

UniProt

Q3V188

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Endou Rabbit Polyclonal Antibody (orb324992) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001162164

Preservative

Lyophilized powder

AA Sequence

VDRSPEPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQQLEEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Human/Mouse/Rat MOG Antibody (8-18C5)
FRH33510 100 μg

Anti-Human/Mouse/Rat MOG Antibody (8-18C5)

Sign In for Pricing
View Details
SREBP-1 (A-4) P
sc-365513 P 100 µg - 0.5 mL

SREBP-1 (A-4) P

Sign In for Pricing
View Details
Collagen α-1 (III) chain (COL3A1) Bovine ELISA Kit
C5086 96 Tests

Collagen α-1 (III) chain (COL3A1) Bovine ELISA Kit

Sign In for Pricing
View Details
Recombinant Human TRKC (N-His tag)
Z500394 10 µg

Recombinant Human TRKC (N-His tag)

Sign In for Pricing
View Details
Human Secernin-2, SCRN2 ELISA Kit
MBS9343396-01 48 Well

Human Secernin-2, SCRN2 ELISA Kit

Sign In for Pricing
View Details
Human Secernin-2, SCRN2 ELISA Kit
MBS9343396-02 96 Well

Human Secernin-2, SCRN2 ELISA Kit

Sign In for Pricing
View Details