Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Endou Peptide - middle region

Endou Peptide - middle region

Product Specifications

Product Name Alternative

Pp11r, Tcl-30

UniProt

Q3V188

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Endou Rabbit Polyclonal Antibody (orb324992) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001162164

Preservative

Lyophilized powder

AA Sequence

VDRSPEPLFTYVNEKLFSKPTYAAFINLLNNYQRATGHGEHFSAQQLEEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Complement Component 4 (C4)
MBS2026332-01 0.1 mL

Polyclonal Antibody to Complement Component 4 (C4)

Sign In for Pricing
View Details
Polyclonal Antibody to Complement Component 4 (C4)
MBS2026332-02 0.2 mL

Polyclonal Antibody to Complement Component 4 (C4)

Sign In for Pricing
View Details
Polyclonal Antibody to Complement Component 4 (C4)
MBS2026332-03 0.5 mL

Polyclonal Antibody to Complement Component 4 (C4)

Sign In for Pricing
View Details
Polyclonal Antibody to Complement Component 4 (C4)
MBS2026332-04 1 mL

Polyclonal Antibody to Complement Component 4 (C4)

Sign In for Pricing
View Details
Polyclonal Antibody to Complement Component 4 (C4)
MBS2026332-05 5 mL

Polyclonal Antibody to Complement Component 4 (C4)

Sign In for Pricing
View Details
Polyclonal Antibody to Complement Component 4 (C4)
MBS2026332-06 5x 5 mL

Polyclonal Antibody to Complement Component 4 (C4)

Sign In for Pricing
View Details