Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tcf23 Peptide - middle region

Tcf23 Peptide - middle region

Product Specifications

Product Name Alternative

2010002O16Rik, Out, bHLHa24

UniProt

Q9JLR5

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tcf23 Rabbit Polyclonal Antibody (orb325608) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_444315

Preservative

Lyophilized powder

AA Sequence

RQAFLALQAALPAVPPDTKLSKLDVLVLATSYIAHLTRTLGHELPGPAWP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Acetyl-4-benzoylpiperidine
TRC-A170625-50MG 50 mg

1-Acetyl-4-benzoylpiperidine

Sign In for Pricing
View Details
Retinol Binding Protein-1 (RBP1) (rRBP1/872), CF568 conjugate, 0.1mg/mL
BNC683603-100 1x 100 µL

Retinol Binding Protein-1 (RBP1) (rRBP1/872), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GIT1 (NM_014030) Human Recombinant Protein
TP320153L 1 mg

GIT1 (NM_014030) Human Recombinant Protein

Sign In for Pricing
View Details
PARP10 Polyclonal Antibody
E-AB-13492-01 20 µL

PARP10 Polyclonal Antibody

Sign In for Pricing
View Details
PARP10 Polyclonal Antibody
E-AB-13492-02 60 µL

PARP10 Polyclonal Antibody

Sign In for Pricing
View Details
PARP10 Polyclonal Antibody
E-AB-13492-03 120 µL

PARP10 Polyclonal Antibody

Sign In for Pricing
View Details