Tcf23 Peptide - middle region
Tcf23 Peptide - middle region
Product Specifications
Product Name Alternative
2010002O16Rik, Out, bHLHa24
UniProt
Q9JLR5
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Tcf23 Rabbit Polyclonal Antibody (orb325608) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_444315
Preservative
Lyophilized powder
AA Sequence
RQAFLALQAALPAVPPDTKLSKLDVLVLATSYIAHLTRTLGHELPGPAWP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![FOXO1A Recombinant Rabbit Monoclonal Antibody [SU33-01]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea80ffc/imageurl/et1608-25.webp)
ET1608-25 100 µL
FOXO1A Recombinant Rabbit Monoclonal Antibody [SU33-01]
Sign In for Pricing
View Details 
BNUB0945-100 1x 100 µL
Double Stranded DNA (dsDNA) (121-3), 0.2mg/mL
Sign In for Pricing
View Details 
BNC680010-100 1x 100 µL
MART-1 / Melan-A (M2-9E3), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 