Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPOCK2 Peptide - C-terminal region

SPOCK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ97039, testican-2

UniProt

Q92563

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPOCK2 Rabbit Polyclonal Antibody (orb326417) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055582

Preservative

Lyophilized powder

AA Sequence

AAKKKPGIFIPSCDEDGYYRKMQCDQSSGDCWCVDQLGLELTGTRTHGSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

G0S2 (G0/G1 Switch Protein 2, G0/G1 Switch Regulatory Protein 2, Putative Lymphocyte G0/G1 Switch Gene) (FITC)
127068-FITC 100 µL

G0S2 (G0/G1 Switch Protein 2, G0/G1 Switch Regulatory Protein 2, Putative Lymphocyte G0/G1 Switch Gene) (FITC)

Sign In for Pricing
View Details
Rabbit Polyclonal ZNF512 Antibody
NBP1-81371 0.1 mL

Rabbit Polyclonal ZNF512 Antibody

Sign In for Pricing
View Details
TTC39B Antibody (C-term)
E45R03519G-4 50 µL

TTC39B Antibody (C-term)

Sign In for Pricing
View Details
Goat anti IgM (mu)
MBS315374-01 2 mg

Goat anti IgM (mu)

Sign In for Pricing
View Details
Goat anti IgM (mu)
MBS315374-02 5x 2 mg

Goat anti IgM (mu)

Sign In for Pricing
View Details
Dcakd sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
17714116 3x 1.0 µg

Dcakd sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details