Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPOCK2 Peptide - C-terminal region

SPOCK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ97039, testican-2

UniProt

Q92563

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPOCK2 Rabbit Polyclonal Antibody (orb326417) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055582

Preservative

Lyophilized powder

AA Sequence

AAKKKPGIFIPSCDEDGYYRKMQCDQSSGDCWCVDQLGLELTGTRTHGSP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SB 218795
MBS5757782 Inquire

SB 218795

Sign In for Pricing
View Details
Recombinant Mouse Meteorin
MBS140695-01 0.001 mg

Recombinant Mouse Meteorin

Sign In for Pricing
View Details
Recombinant Mouse Meteorin
MBS140695-02 0.005 mg

Recombinant Mouse Meteorin

Sign In for Pricing
View Details
Recombinant Mouse Meteorin
MBS140695-03 0.05 mg

Recombinant Mouse Meteorin

Sign In for Pricing
View Details
Recombinant Mouse Meteorin
MBS140695-04 5x 0.05 mg

Recombinant Mouse Meteorin

Sign In for Pricing
View Details
3H,4H,5H,6H,7H,8H-Pyrido[4,3-d]pyrimidin-4-one dihydrochloride
JEA22908-01 250 mg

3H,4H,5H,6H,7H,8H-Pyrido[4,3-d]pyrimidin-4-one dihydrochloride

Sign In for Pricing
View Details