Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFA8 Peptide - N-terminal region

NDUFA8 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CI-19KD, CI-PGIV, MGC793, PGIV

UniProt

P51970

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFA8 Rabbit Polyclonal Antibody (orb585331) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055037

Preservative

Lyophilized powder

AA Sequence

LKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDFFRQI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Integrin beta 5/ITGB5 Antibody Picoband®, iFluor647 Conjugate
A04201-1-iFluor647 100 µg

Anti-Integrin beta 5/ITGB5 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
Rabbit anti-ERK1/2 Antibody
YLD2908-01 50 µL

Rabbit anti-ERK1/2 Antibody

Sign In for Pricing
View Details
Rabbit anti-ERK1/2 Antibody
YLD2908-02 100 µL

Rabbit anti-ERK1/2 Antibody

Sign In for Pricing
View Details
Hoxb13 Peptide - N-terminal region (AAP36889)
AAP36889-100UG 100 µg

Hoxb13 Peptide - N-terminal region (AAP36889)

Sign In for Pricing
View Details
PARP1 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-20763R-APC-Cy5.5 100 µL

PARP1 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal CD43/Sialophorin Antibody (SPN/1766R)
NBP2-53288-100ug 100 µg

Rabbit Monoclonal CD43/Sialophorin Antibody (SPN/1766R)

Sign In for Pricing
View Details