Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFXN2 Peptide - C-terminal region

SFXN2 Peptide - C-terminal region

Product Specifications

UniProt

Q96NB2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SFXN2 Rabbit Polyclonal Antibody (orb585377) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_849189

Preservative

Lyophilized powder

AA Sequence

AANCVNIPMMRQQELIKGICVKDRNENEIGHSRRAAAIGITQVVISRITM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cadmium Foil 0.25mm, 99.99%
GX0787-100x200mm 100x 200 mm

Cadmium Foil 0.25mm, 99.99%

Sign In for Pricing
View Details
Streptavidin (AP) (Streptomyces avidinii) discontinued
S7973-77A 2 mL

Streptavidin (AP) (Streptomyces avidinii) discontinued

Sign In for Pricing
View Details
Mouse Ifna12 qPCR Primer Pair
QM63074S 200 Tests

Mouse Ifna12 qPCR Primer Pair

Sign In for Pricing
View Details
C18orf8 (Chromosome 18 Open Reading Frame 8, Colon Cancer-associated Protein Mic1, MIC1, Mic-1, HsT2591) (MaxLight 405)
MBS6409055-01 0.1 mL

C18orf8 (Chromosome 18 Open Reading Frame 8, Colon Cancer-associated Protein Mic1, MIC1, Mic-1, HsT2591) (MaxLight 405)

Sign In for Pricing
View Details
C18orf8 (Chromosome 18 Open Reading Frame 8, Colon Cancer-associated Protein Mic1, MIC1, Mic-1, HsT2591) (MaxLight 405)
MBS6409055-02 5x 0.1 mL

C18orf8 (Chromosome 18 Open Reading Frame 8, Colon Cancer-associated Protein Mic1, MIC1, Mic-1, HsT2591) (MaxLight 405)

Sign In for Pricing
View Details
Anti-HRP Purified
11-262-C100 0.1 mg

Anti-HRP Purified

Sign In for Pricing
View Details