Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFXN2 Peptide - C-terminal region

SFXN2 Peptide - C-terminal region

Product Specifications

UniProt

Q96NB2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SFXN2 Rabbit Polyclonal Antibody (orb585377) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_849189

Preservative

Lyophilized powder

AA Sequence

AANCVNIPMMRQQELIKGICVKDRNENEIGHSRRAAAIGITQVVISRITM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Plasmodium Knowlesi TCTP Protein (aa 1-171)
VAng-Wyb7824-100gBaculovirus 100 µg (Baculovirus)

Recombinant Plasmodium Knowlesi TCTP Protein (aa 1-171)

Sign In for Pricing
View Details
Human RNA Polymerase II Associated Protein 3 (RPAP3) ELISA Kit
abx382888 96 Tests

Human RNA Polymerase II Associated Protein 3 (RPAP3) ELISA Kit

Sign In for Pricing
View Details
Human Heat Shock Protein 90Α (Hsp-90Α) Elisa Kit
EKC41013 96 Tests

Human Heat Shock Protein 90Α (Hsp-90Α) Elisa Kit

Sign In for Pricing
View Details
SSX2 (Synovial Sarcoma X Breakpoint 2, Cancer/testis Antigen 5.2, CT5.2, CT5.2a, Protein SSX2, SSX2A, SSX2B, Tumor Antigen HOM-MEL-40, MGC119055, MGC15364, MGC3884) (MaxLight 550)
133882-ML550 100 µL

SSX2 (Synovial Sarcoma X Breakpoint 2, Cancer/testis Antigen 5.2, CT5.2, CT5.2a, Protein SSX2, SSX2A, SSX2B, Tumor Antigen HOM-MEL-40, MGC119055, MGC15364, MGC3884) (MaxLight 550)

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (NM_019010) Human Recombinant Protein
E45H32282E1 50 µg

Cytokeratin 20 (KRT20) (NM_019010) Human Recombinant Protein

Sign In for Pricing
View Details
Exosome OPN antibody (APC Conjugated)
E6E03F29001-APC 100 µL

Exosome OPN antibody (APC Conjugated)

Sign In for Pricing
View Details