Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACR Peptide - C-terminal region

ACR Peptide - C-terminal region

Product Specifications

UniProt

P10323

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACR Rabbit Polyclonal Antibody (orb585501) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001088

Preservative

Lyophilized powder

AA Sequence

GKIDTCQGDSGGPLMCKDSKESAYVVVGITSWGVGCARAKRPGIYTATWP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNA1 Antibody
KC-020-01 50 μL

IFNA1 Antibody

Sign In for Pricing
View Details
IFNA1 Antibody
KC-020-02 100 µL

IFNA1 Antibody

Sign In for Pricing
View Details
IFNA1 Antibody
KC-020-03 1 mL

IFNA1 Antibody

Sign In for Pricing
View Details
VWA5B1 Human Gene Knockout Kit (CRISPR)
KN426681 1 Kit

VWA5B1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Ethyl 2,3-Dibromopropanoate
TRC-E915840-50G 50 g

Ethyl 2,3-Dibromopropanoate

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD (K378N) (His Tag)
PKSV030437 100 µg

Recombinant SARS-CoV-2 Spike RBD (K378N) (His Tag)

Sign In for Pricing
View Details