Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADCK2 Peptide - C-terminal region

ADCK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

AARF, MGC20727

UniProt

Q7Z695

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADCK2 Rabbit Polyclonal Antibody (orb585543) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443085

Preservative

Lyophilized powder

AA Sequence

VAELILHHARASECRDVEGFKTEMAMLVTQARKNTITLEKLHVSSLLSSV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRK1 Polyclonal Antibody
bs-1082R 100 µL

GRK1 Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Dscam shRNA (UAS) - Lentiviral mouse Dscam shRNA (UAS, iRFP) (100)
GTR15265551 1 Vial

Lentiviral mouse Dscam shRNA (UAS) - Lentiviral mouse Dscam shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Thyroglobulin (TG) Mouse Monoclonal Antibody [Clone ID: 2H11 + 6E1]
AM10143PU-T 20 µg

Thyroglobulin (TG) Mouse Monoclonal Antibody [Clone ID: 2H11 + 6E1]

Sign In for Pricing
View Details
Lentiviral human ASF1A sgRNA gene knockout kit - Lentiviral human ASF1A sgRNA gene knockout kit (plasmid)
GTR15359024 1 Vial

Lentiviral human ASF1A sgRNA gene knockout kit - Lentiviral human ASF1A sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
GOLT1A shRNA (h) Lentiviral Particles
sc-78910-V 200 µL

GOLT1A shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
PER2 Rabbit pAb
A3217 200 µL

PER2 Rabbit pAb

Sign In for Pricing
View Details