Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCKBR Peptide - C-terminal region

CCKBR Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCK-B, CCK2R, GASR

UniProt

P32239

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCKBR Rabbit Polyclonal Antibody (orb331216) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_795344

Preservative

Lyophilized powder

AA Sequence

GRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C Antibody, Biotin Conjugated
MBS7113737-01 0.05 mL

C Antibody, Biotin Conjugated

Sign In for Pricing
View Details
C Antibody, Biotin Conjugated
MBS7113737-02 0.1 mL

C Antibody, Biotin Conjugated

Sign In for Pricing
View Details
C Antibody, Biotin Conjugated
MBS7113737-03 5x 0.1 mL

C Antibody, Biotin Conjugated

Sign In for Pricing
View Details
GIT1 Antibody
MBS7122040-01 0.05 mg

GIT1 Antibody

Sign In for Pricing
View Details
GIT1 Antibody
MBS7122040-02 0.1 mg

GIT1 Antibody

Sign In for Pricing
View Details
GIT1 Antibody
MBS7122040-03 5x 0.1 mg

GIT1 Antibody

Sign In for Pricing
View Details