Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCKBR Peptide - C-terminal region

CCKBR Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCK-B, CCK2R, GASR

UniProt

P32239

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCKBR Rabbit Polyclonal Antibody (orb331216) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_795344

Preservative

Lyophilized powder

AA Sequence

GRCRPETGAVGEDSDGCYVQLPRSRPALELTALTAPGPGSGSRPTQAKLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ndufs7 Rat siRNA Oligo Duplex (Locus ID 362837)
SR506418 1 Kit

Ndufs7 Rat siRNA Oligo Duplex (Locus ID 362837)

Sign In for Pricing
View Details
MAP4K3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K1265005 3x 1.0 µg

MAP4K3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
PARP1 Antibody
E031288 100 µg -100 µL

PARP1 Antibody

Sign In for Pricing
View Details
Rabbit Arylsulfatase B (ARSB) ELISA Kit
GTR10335353 96 Well

Rabbit Arylsulfatase B (ARSB) ELISA Kit

Sign In for Pricing
View Details
PEA15 Polyclonal Antibody, Cy5.5 Conjugated
bs-3524R-Cy5.5 100 µL

PEA15 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
MUC5AC Antibody
V2739-20UG 20 µg

MUC5AC Antibody

Sign In for Pricing
View Details