Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC4R Peptide - N-terminal region

MC4R Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC126851, MGC138197

UniProt

P32245

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MC4R Rabbit Polyclonal Antibody (orb331217) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005903

Preservative

Lyophilized powder

AA Sequence

VNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQLFVSPEVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Chloroethyl 2,2,2-trifluoroethyl ether
PC3546-01 1 g

2-Chloroethyl 2,2,2-trifluoroethyl ether

Sign In for Pricing
View Details
2-Chloroethyl 2,2,2-trifluoroethyl ether
PC3546-02 5 g

2-Chloroethyl 2,2,2-trifluoroethyl ether

Sign In for Pricing
View Details
2-Chloroethyl 2,2,2-trifluoroethyl ether
PC3546-03 25 g

2-Chloroethyl 2,2,2-trifluoroethyl ether

Sign In for Pricing
View Details
TrkC (GP145-TrkC, NTRK3, NT-3 Growth Factor Receptor, Neurotrophic Tyrosine Kinase Receptor Type 3, TrkC Tyrosine Kinase) (MaxLight 650)
134780-ML650 100 µL

TrkC (GP145-TrkC, NTRK3, NT-3 Growth Factor Receptor, Neurotrophic Tyrosine Kinase Receptor Type 3, TrkC Tyrosine Kinase) (MaxLight 650)

Sign In for Pricing
View Details
TBC1D7 Protein Vector (Mouse) (pPB-N-His)
PV236743 500 ng

TBC1D7 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Human ARF6
P1673-01 50 µg

Recombinant Human ARF6

Sign In for Pricing
View Details