Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MC4R Peptide - N-terminal region

MC4R Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC126851, MGC138197

UniProt

P32245

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MC4R Rabbit Polyclonal Antibody (orb331217) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005903

Preservative

Lyophilized powder

AA Sequence

VNSTHRGMHTSLHLWNRSSYRLHSNASESLGKGYSDGGCYEQLFVSPEVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNORD109A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2236705 3x 1.0 µg

SNORD109A sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
[1,2,4]Triazolo[1,5-a]pyrimidine-2-carboxylic acid
NT57365-01 100 mg

[1,2,4]Triazolo[1,5-a]pyrimidine-2-carboxylic acid

Sign In for Pricing
View Details
[1,2,4]Triazolo[1,5-a]pyrimidine-2-carboxylic acid
NT57365-02 250 mg

[1,2,4]Triazolo[1,5-a]pyrimidine-2-carboxylic acid

Sign In for Pricing
View Details
[1,2,4]Triazolo[1,5-a]pyrimidine-2-carboxylic acid
NT57365-03 500 mg

[1,2,4]Triazolo[1,5-a]pyrimidine-2-carboxylic acid

Sign In for Pricing
View Details
Ethyl 3-hydroxy-2,2-dimethylhexanoate
OR1045066-01 100 mg

Ethyl 3-hydroxy-2,2-dimethylhexanoate

Sign In for Pricing
View Details
Ethyl 3-hydroxy-2,2-dimethylhexanoate
OR1045066-02 250 mg

Ethyl 3-hydroxy-2,2-dimethylhexanoate

Sign In for Pricing
View Details