KLRK1 Peptide - C-terminal region
KLRK1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CD314, D12S2489E, FLJ17759, FLJ75772, KLR, NKG2-D, NKG2D
UniProt
P26718
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KLRK1 Rabbit Polyclonal Antibody (orb585587) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_031386
Preservative
Lyophilized powder
AA Sequence
HIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSTPNT
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![p16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: OTI4E11]](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
TA809937S 30 µL
p16INK4A (CDKN2A) Mouse Monoclonal Antibody [Clone ID: OTI4E11]
Sign In for Pricing
View Details K0698403 1.0 µg DNA
ETF1P3 sgRNA CRISPR Lentivector (Human) (Target 2)
Sign In for Pricing
View Details 