Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NGFR Peptide - C-terminal region

NGFR Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD271, Gp80-LNGFR, TNFRSF16, p75 (NTR), p75NTR

UniProt

P08138

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NGFR Rabbit Polyclonal Antibody (orb331221) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002498

Preservative

Lyophilized powder

AA Sequence

VTRGTTDNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Electric Wheelchair BHBD-912
BHBD-912 1 Unit

Electric Wheelchair BHBD-912

Sign In for Pricing
View Details
Frozen Tissue Sections, Skin
CS636509 5x 5 µm

Frozen Tissue Sections, Skin

Sign In for Pricing
View Details
SARS-CoV-2 Nucleocapsid protein (P13L, R203K, G204R, G214C), His Tag
NUN-C52Ha-1mg 1 mg

SARS-CoV-2 Nucleocapsid protein (P13L, R203K, G204R, G214C), His Tag

Sign In for Pricing
View Details
CD45 / LCA (Leucocyte Marker) (PTPRC/1783R + PTPRC/1975R), CF640R conjugate, 0.1mg/mL
BNC402026-100 1x 100 µL

CD45 / LCA (Leucocyte Marker) (PTPRC/1783R + PTPRC/1975R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DATP *100 mM PCR Grade*
17250-AAT 500 µL

DATP *100 mM PCR Grade*

Sign In for Pricing
View Details
Human LECT2 activation kit by CRISPRa
GA102676 1 Kit

Human LECT2 activation kit by CRISPRa

Sign In for Pricing
View Details