Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KLRD1 Peptide - middle region

KLRD1 Peptide - middle region

Product Specifications

Product Name Alternative

CD94

UniProt

Q13241

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KLRD1 Rabbit Polyclonal Antibody (orb585592) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002253

Preservative

Lyophilized powder

AA Sequence

CQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAD4 Protein Vector (Human) (pPM-C-His)
PV138553 500 ng

TRNAD4 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
COX6c Rabbit Polyclonal Antibody (Cy5)
orb921676 100 µL

COX6c Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Bcl10 Rabbit pAb
APA1686-01 30 µL

Bcl10 Rabbit pAb

Sign In for Pricing
View Details
Bcl10 Rabbit pAb
APA1686-02 50 μL

Bcl10 Rabbit pAb

Sign In for Pricing
View Details
Bcl10 Rabbit pAb
APA1686-03 100 µL

Bcl10 Rabbit pAb

Sign In for Pricing
View Details
Mouse Sephs1 qPCR Primer Pair
QM50862S 200 Tests

Mouse Sephs1 qPCR Primer Pair

Sign In for Pricing
View Details